Mouse Scavenger Receptor Class D Member 1 (SCARD1) Protein
247€ (10 µg)
Por favor contáctenos para obtener información detallada sobre el precio y disponibilidad.
935106861
info@markelab.com
name
Mouse Scavenger Receptor Class D Member 1 (SCARD1) Protein
category
Proteins and Peptides
provider
Abbexa
reference
abx167510
tested applications
WB, SDS-PAGE
Description
Scavenger Receptor Class D Member 1 Protein is a recombinant Mouse protein expressed in E. coli.
Documents del producto
Instrucciones
Data sheet
Product specifications
| Category | Proteins and Peptides |
| Immunogen Target | Scavenger Receptor Class D Member 1 (SCARD1) |
| Host | E. coli |
| Origin | Mouse |
| Conjugation | Unconjugated |
| Observed MW | Molecular Weight: Calculated MW: 61.4 kDa Concentration: Prior to lyophilization: 200 µg/ml Sequence Fragment: Ala27-Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA Tag: N-terminal His tag and GST tag |
| Expression | Recombinant |
| Purity | > 97% |
| Size 1 | 10 µg |
| Size 2 | 50 µg |
| Size 3 | 100 µg |
| Size 4 | 200 µg |
| Size 5 | 500 µg |
| Form | Lyophilized To keep the original salt concentration, we recommend reconstituting to the original concentration prior to lyophilization (see Concentration) in ddH2O. If a lower concentration is required, dilute in PBS, pH 7.4. If a higher concentration is required, the product can be reconstituted directly in PBS, pH 7.4, though please note that this will change the overall salt concentration. The stock concentration should be between 0.1-1.0 mg/ml. Do not vortex. |
| Tested Applications | WB, SDS-PAGE |
| Buffer | Prior to lyophilization: PBS, pH 7.4, containing 0.01% Sarcosyl, 1 mM DTT, 5% Trehalose and Proclin-300. |
| Availability | Shipped within 5-7 working days. |
| Storage | Store at 2-8 °C for up to one month. Store at -80 °C for up to one year. Avoid repeated freeze/thaw cycles. |
| Dry Ice | No |
| Alias | GP110,LAMP4,SCARD1,Macrosialin |
| Background | Protein CD68 |
| Status | RUO |
| Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |
Descripción
CD68 is a glycoprotein primarily expressed by cells of the monocyte/macrophage lineage. It belongs to the family of lysosomal-associated membrane proteins (LAMPs) and is widely used as a marker for macrophages, monocytes, dendritic cells, and other myeloid lineage cells. Although CD68 is predominantly associated with immune system cells, it is also found in some non-hematopoietic tissues and other cell types under certain conditions, such as fibroblasts and endothelial cells. This broad expression pattern supports its diverse role in cellular processes like phagocytosis, cell adhesion, and antigen presentation. CD68 is heavily involved in macrophage biology, specifically in processes like scavenging cellular debris, tissue remodeling, and immune surveillance. This protein plays a significant role in the clearance of pathogens and apoptotic cells, contributing to immune homeostasis. It is mainly located in lysosomes and endosomes, though it can also be present on the plasma membrane.
Related Products
Human CD68 (Macrosialin) ELISA Kit
Ver Producto
Mouse CD68 (Macrosialin) ELISA Kit
Ver Producto