Human Enolase, Neuron Specific (NSE) Protein

208€ (10 µg)
Por favor contáctenos para obtener información detallada sobre el precio y disponibilidad.
935106861
info@markelab.com
name
Human Enolase, Neuron Specific (NSE) Protein
category
Proteins and Peptides
provider
Abbexa
reference
abx066426
tested applications
WB, SDS-PAGE
Description
Recombinant ENO2 is a recombinant Human protein produced in a Prokaryotic expression system (E. coli).
Documents del producto
Instrucciones
Data sheet
Product specifications
| Category | Proteins and Peptides |
| Immunogen Target | Enolase, Neuron Specific (NSE) |
| Host | E. coli |
| Origin | Human |
| Conjugation | Unconjugated |
| Observed MW | Molecular Weight: Calculated MW: 37.1 kDa Concentration: Prior to lyophilization: 200 µg/ml Sequence Fragment: Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT Tag: N-terminal His tag |
| Expression | Recombinant |
| Purity | > 97% |
| Size 1 | 10 µg |
| Size 2 | 50 µg |
| Size 3 | 100 µg |
| Size 4 | 200 µg |
| Size 5 | 500 µg |
| Form | Lyophilized To keep the original salt concentration, we recommend reconstituting to the original concentration prior to lyophilization (see Concentration) in ddH2O. If a lower concentration is required, dilute in PBS, pH 7.4. If a higher concentration is required, the product can be reconstituted directly in PBS, pH 7.4, though please note that this will change the overall salt concentration. The stock concentration should be between 0.1-1.0 mg/ml. Do not vortex. |
| Tested Applications | WB, SDS-PAGE |
| Buffer | Prior to lyophilization: PBS, pH 7.4, containing 0.01% Sarcosyl, 1 mM DTT, 5% Trehalose and Proclin-300. |
| Availability | Shipped within 5-12 working days. |
| Storage | Store at 2-8 °C for up to one month. Store at -80 °C for up to one year. Avoid repeated freeze/thaw cycles. |
| Dry Ice | No |
| UniProt ID | P09104 |
| Background | Protein NSE |
| Status | RUO |
| Note | This product is for research use only. Not for human consumption, cosmetic, therapeutic or diagnostic use. |
Descripción
Related Products

Human NSE (Neuron-specific Enolase) high sensitivity ELISA Kit
Ver Producto
Mouse NSE (Neuron-Specific Enolase) ELISA Kit
Ver Producto